PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462932634
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family TALE
Protein Properties Length: 1023aa    MW: 114039 Da    PI: 6.5393
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462932634genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.61e-087838201954
                HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                Fe   ++yp+ +e+  LA+++gLt +q+++WF N R +
  462932634 783 FEHflHPYPKDSEKLMLARQTGLTRSQISNWFINARVR 820
                665559******************************88 PP

2BELL118.33.6e-38500571172
       BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                e+qelq+k akL+ +l+eVd++Yk+y++q+qtv+ssF++vag g+akpYt++Al++iSrhFrcLkdai +qi
  462932634 500 EKQELQNKMAKLMAMLDEVDRKYKHYYHQMQTVVSSFDVVAGPGAAKPYTAVALHTISRHFRCLKDAINDQI 571
                689*******************************************************************98 PP

3BELL93.12.7e-306627171772
       BELL  17 eeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 +Vd++Yk+y++q+qtv+ssF++vag g+akpYt++Al++iSrhFrcLkdai +qi
  462932634 662 SQVDRKYKHYYHQMQTVVSSFDVVAGPGAAKPYTAVALHTISRHFRCLKDAINDQI 717
                58****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.1E-5194332IPR006563POX domain
PfamPF075263.3E-16200287IPR006563POX domain
SMARTSM005741.3E-56424569IPR006563POX domain
PfamPF075261.1E-50430567IPR006563POX domain
Gene3DG3DSA:1.10.10.604.1E-15617665IPR009057Homeodomain-like
SMARTSM003890.18618677IPR001356Homeobox domain
CDDcd000861.46E-4618670No hitNo description
SuperFamilySSF466892.35E-8619677IPR009057Homeodomain-like
SMARTSM005746.1E-9626715IPR006563POX domain
PfamPF059203.2E-8635665IPR008422Homeobox KN domain
PfamPF075263.5E-25663713IPR006563POX domain
PROSITE profilePS5007112.325761824IPR001356Homeobox domain
SMARTSM003893.6E-9764828IPR001356Homeobox domain
CDDcd000861.75E-11764825No hitNo description
SuperFamilySSF466895.13E-17765830IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-27767830IPR009057Homeodomain-like
PfamPF059201.8E-17781820IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003677Molecular FunctionDNA binding
GO:0003677Molecular FunctionDNA binding
GO:0003677Molecular FunctionDNA binding
GO:0003677Molecular FunctionDNA binding
GO:0003677Molecular FunctionDNA binding
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1023 aa     Download sequence    Send to blast
MATYYSSPGT ERDSQNMYSR DPGGASYPMP SALGNLLYLN NPTSGPYTEF SGILQSQQNC  60
MEIPDPGHPS VMSQDSSARE SDMLGSHQGQ HSFNSVKDMK NEMLMHMMDG SQSSTANLIH  120
DDAHNGAQLE FGVLNNHSPS NVHSVQGQGL SLSLNTQILA PSLPYWSIKP DMLSPQSYHD  180
SLRVDDIRMK SMQSEASRAI RNSRYLKAAQ ELLDEVVNVW KNIKQKAQKE QGDAGKADGK  240
ENEGGPKSEG VSSNPQESAA NTAPELSTAE KQELQNKMAK LMAMLDEQNC MEIPDPGHPS  300
VMSQDSSARE SDMLGSHQGQ HSFNSVKDMK NEMLMHMMDG SQSSTANLIH DDAHNGAQLE  360
FGVLNNHSPS NVPSVQGQGL SLSLNTQILA PSLPYWSVKP DMLSPQSYHD SLRVDDIRMK  420
SMQSEASRAI RNSRYLKAAQ ELLDEVVNVW KNIKQKAQKE QGDAGKVDGK ETEGEPKSEG  480
VSSNPQESAA NTAPELSTAE KQELQNKMAK LMAMLDEVDR KYKHYYHQMQ TVVSSFDVVA  540
GPGAAKPYTA VALHTISRHF RCLKDAINDQ INVIRRKLGE EENSSGKEGK LTRLRYIDQQ  600
LRQQRAFQQY GMIPQNAWRP QRGLPENSVT ILRAWLFEHF LHPYPKDSEK LMLARQTGLT  660
RSQVDRKYKH YYHQMQTVVS SFDVVAGPGA AKPYTAVALH TISRHFRCLK DAINDQINVI  720
RKKLGEEENS SGKEGKLTRL RYIDQQLRQQ RAFQQYGIIP QNAWRPQRGL PENSVTILRA  780
WLFEHFLHPY PKDSEKLMLA RQTGLTRSQI SNWFINARVR LWKPMIEDMY KEEIGDIEQD  840
SNSSSDNAPR SKAEVASSED KEGLKSSTPR VCETSQLSES RASIGTVNVG GAPVGFQNEA  900
NPDESFMNLM LKDQRSNDTD GGLLLHNAVA HHPDENARFM AYHLAELGRY GNGNVSLTLG  960
LQHSSSSLSV PNAQQSFPGV GDDIYNATAP LGASVASSDY ESMNQMDQRQ RFEQSPLLHD  1020
FVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-15770827562Homeobox protein Meis2
3k2a_B1e-15770827562Homeobox protein Meis2
4xrs_A9e-16770827158Homeobox protein Meis1
4xrs_B9e-16770827158Homeobox protein Meis1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963321.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_004963320.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_004963319.10.0PREDICTED: BEL1-like homeodomain protein 7
SwissprotQ9SIW12e-97BLH7_ARATH; BEL1-like homeodomain protein 7
TrEMBLK3Z4G80.0K3Z4G8_SETIT; Uncharacterized protein
STRINGSi021436m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90138131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.12e-84BEL1-like homeodomain 7